Upb1 (NM_133995) Mouse Recombinant Protein

CAT#: TP506150

Purified recombinant protein of Mouse ureidopropionase, beta (Upb1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206150 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGPEWQSLEQCLEKHLPPDDLAQVKRILYGKQTRNLDLPREALKAASERNFELKGYAFGAAKEQQRCPQ
  IVRVGLVQNRIPLPTSAPVAEQVSALHKSIEEIAEVAAMCGVNIICFQEAWNMPFAFCTREKLPWTEFAE
  SAEDGLTTRFCQKLAKKHNMVVVSPILERDREHGGVLWNTAVVISNSGLVMGKTRKNHIPRVGDFNESTY
  YMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYSINGAEIIFNPSATIGELSESLWPIEARNAAIANH
  CFTCALNRVGQEHFPNEFTSGDGKKAHHDLGYFYGSSYVAAPDGSRTPGLSRNQDGLLVTELNLNLCQQI
  NDFWTFKMTGRLEMYARELAEAVKPNYSPNIVKEDLVLAPSSG
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 43.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_598756
• Locus ID: 103149
• UniProt ID: Q8VC97, Q3UEK4
• Cytogenetics: 10 C1
• Refseq Size: 3042
• Refseq ORF: 1182
• Synonyms: AI195023
• Summary: This gene encodes an enzyme that catalyzes the conversion of N-carbamyl-beta-aminoisobutyric acid and N-carbamyl-beta-alanine to beta-aminoisobutyric acid or beta-alanine. Mutations in the related gene in human have been associated with beta-ureidopropionase deficiency. [provided by RefSeq, Dec 2013]