Rabbit Polyclonal Anti-UPB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UPB1 antibody: synthetic peptide directed towards the middle region of human UPB1. Synthetic peptide located within the following region: AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV |
Rabbit Polyclonal Anti-UPB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UPB1 antibody: synthetic peptide directed towards the middle region of human UPB1. Synthetic peptide located within the following region: NRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDG |
UPB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human UPB1 (NP_057411.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China