Polr1d (NM_181730) Mouse Recombinant Protein

CAT#: TP500671

Purified recombinant protein of Mouse polymerase (RNA) I polypeptide D (Polr1d), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200671 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEDDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLAGTNKRFLINTIKNTLPSHKEQDHEQKEGSK
  EPGKSQDQKEASGKKYRSHSYKRSLHSSRGSAGCSPPRKRTSRTSGDKCDPRPSRR
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 14.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_859419
• Locus ID: 20018
• UniProt ID: Q9D1M1
• Cytogenetics: 5 G3
• Refseq Size: 1147
• Refseq ORF: 381
• Synonyms: 16kD; 1110003G10Rik; AC19; mRP; RPA16; Rpo; Rpo1-3
• Summary: This gene encodes an RNA polymerase subunit that is a component of both the RNA polymerase I and RNA polymerase III complexes. RNA polymerase I is associated with transcription of pre-ribosomal RNAs, while RNA polymerase III is associated with transcription of small RNAs. Pseudogenes of this gene have been defined on chromosomes 4 and 6. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]