CED6 (GULP1) (NM_016315) Human Recombinant Protein
CAT#: TP321580
Recombinant protein of human GULP, engulfment adaptor PTB domain containing 1 (GULP1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221580 representing NM_016315
Red=Cloning site Green=Tags(s) MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKV ELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLT IGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSAPPAGSMTPK SPSTDIFDMIPFSPISHQSSMPTRNGTQPPPVPSRSTEIKRDLFGAEPFDPFNCGAADFPPDIQSKLDEM QEGFKMGLTLEGTVFCLDPLDSRC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057399 |
Locus ID | 51454 |
UniProt ID | Q9UBP9 |
Cytogenetics | 2q32.1-q32.2 |
Refseq Size | 3464 |
Refseq ORF | 912 |
Synonyms | CED-6; CED6; GULP |
Summary | The protein encoded by this gene is an adapter protein necessary for the engulfment of apoptotic cells by phagocytes. Several transcript variants, some protein coding and some thought not to be protein coding, have been found for this gene. [provided by RefSeq, Nov 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414050 | GULP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414050 | Transient overexpression lysate of GULP, engulfment adaptor PTB domain containing 1 (GULP1) |
USD 436.00 |
|
PH321580 | GULP1 MS Standard C13 and N15-labeled recombinant protein (NP_057399) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review