Junctional Adhesion Molecule 1 (F11R) (NM_016946) Human Recombinant Protein
CAT#: TP321478
Recombinant protein of human F11 receptor (F11R), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221478 representing NM_016946
Red=Cloning site Green=Tags(s) MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTT RLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIP SSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEY SCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIY SQPSARSEGEFKQTSSFLV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_058642 |
Locus ID | 50848 |
UniProt ID | Q9Y624, Q6FIB4 |
Cytogenetics | 1q23.3 |
Refseq Size | 3660 |
Refseq ORF | 897 |
Synonyms | CD321; JAM; JAM1; JAMA; JCAM; KAT; PAM-1 |
Summary | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is an important regulator of tight junction assembly in epithelia. In addition, the encoded protein can act as (1) a receptor for reovirus, (2) a ligand for the integrin LFA1, involved in leukocyte transmigration, and (3) a platelet receptor. Multiple 5' alternatively spliced variants, encoding the same protein, have been identified but their biological validity has not been established. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Epithelial cell signaling in Helicobacter pylori infection, Leukocyte transendothelial migration, Tight junction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403392 | F11R HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC413796 | F11R HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC429529 | F11R HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403392 | Transient overexpression lysate of F11 receptor (F11R), transcript variant 5 |
USD 436.00 |
|
LY413796 | Transient overexpression lysate of F11 receptor (F11R) |
USD 436.00 |
|
PH300004 | F11R MS Standard C13 and N15-labeled recombinant protein (NP_653087) |
USD 3,255.00 |
|
PH321478 | F11R MS Standard C13 and N15-labeled recombinant protein (NP_058642) |
USD 3,255.00 |
|
TP300004 | Recombinant protein of human F11 receptor (F11R), transcript variant 5, 20 µg |
USD 867.00 |
|
TP720393 | Recombinant protein of human F11 receptor (F11R) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review