alpha smooth muscle Actin (ACTA2) (NM_001141945) Human Mass Spec Standard

CAT#: PH327802

ACTA2 MS Standard C13 and N15-labeled recombinant protein (NP_001135417)

Product Images

Coomassie blue staining of purified ACTA2 protein (Cat# TP327802). The protein was produced from HEK293T cells transfected with ACTA2 cDNA clone (Cat# RC227802) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227802
• Predicted MW: 42 kDa
• Protein Sequence:
  Sequence Link

  >RC227802 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK
  YPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA
  VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI
  VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT
  YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS
  LSTFQQMWISKQEYDEAGPSIVHRKCF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001135417
• RefSeq Size: 1798
• RefSeq ORF: 1131
• Synonyms: ACTSA
• Locus ID: 59
• UniProt ID: P62736, D2JYH4
• Cytogenetics: 10q23.31
• Summary: This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome. [provided by RefSeq, Sep 2017]
• Protein Pathways: Vascular smooth muscle contraction