MYL12B (NM_001144946) Human Mass Spec Standard
CAT#: PH327035
MYL12B MS Standard C13 and N15-labeled recombinant protein (NP_001138418)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227035 |
Predicted MW | 17.6 kDa |
Protein Sequence |
>RC227035 representing NM_001144946
Red=Cloning site Green=Tags(s) MSSMFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLT MFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIE FTRILKHGAKDKDD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001138418 |
RefSeq ORF | 462 |
Synonyms | MLC-B; MRLC2 |
Locus ID | 103910 |
UniProt ID | O14950 |
Cytogenetics | 18p11.31 |
Summary | The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]).[supplied by OMIM, Mar 2008] |
Protein Pathways | Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403261 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428596 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428597 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428598 | MYL12B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403261 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 2 |
USD 436.00 |
|
LY428596 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 1 |
USD 436.00 |
|
LY428597 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 3 |
USD 436.00 |
|
LY428598 | Transient overexpression lysate of myosin, light chain 12B, regulatory (MYL12B), transcript variant 4 |
USD 436.00 |
|
PH301372 | MYL12B MS Standard C13 and N15-labeled recombinant protein (NP_291024) |
USD 3,255.00 |
|
TP301372 | Recombinant protein of human myosin, light chain 12B, regulatory (MYL12B), transcript variant 2, 20 µg |
USD 867.00 |
|
TP327035 | Purified recombinant protein of Homo sapiens myosin, light chain 12B, regulatory (MYL12B), transcript variant 4, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review