MYL12B (NM_001144946) Human Mass Spec Standard

CAT#: PH327035

MYL12B MS Standard C13 and N15-labeled recombinant protein (NP_001138418)

Product Images

Coomassie blue staining of purified MYL12B protein (Cat# TP327035). The protein was produced from HEK293T cells transfected with MYL12B cDNA clone (Cat# RC227035) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227035
• Predicted MW: 17.6 kDa
• Protein Sequence:
  Sequence Link

  >RC227035 representing NM_001144946
  Red=Cloning site Green=Tags(s)
  
  MSSMFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLT
  MFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIE
  FTRILKHGAKDKDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001138418
• RefSeq ORF: 462
• Synonyms: MLC-B; MRLC2
• Locus ID: 103910
• UniProt ID: O14950
• Cytogenetics: 18p11.31
• Summary: The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]).[supplied by OMIM, Mar 2008]
• Protein Pathways: Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction