Serum Amyloid P (APCS) (NM_001639) Human Mass Spec Standard

CAT#: PH302802

APCS MS Standard C13 and N15-labeled recombinant protein (NP_001630)

Product Images

Coomassie blue staining of purified APCS protein (Cat# TP302802). The protein was produced from HEK293T cells transfected with APCS cDNA clone (Cat# RC202802) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202802
• Predicted MW: 25.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202802 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNKPLLWISVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLFS
  YNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESSSGIAEFWINGTPLVKKGLRQ
  GYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYE
  IRGYVIIKPLVWV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001630
• RefSeq Size: 960
• RefSeq ORF: 669
• Synonyms: HEL-S-92n; PTX2; SAP
• Locus ID: 325
• UniProt ID: P02743, V9HWP0
• Cytogenetics: 1q23.2
• Summary: The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. [provided by RefSeq, Sep 2008]
• Protein Families: Druggable Genome, Secreted Protein