CDK7 (NM_001799) Human Mass Spec Standard

CAT#: PH302736

CDK7 MS Standard C13 and N15-labeled recombinant protein (NP_001790)

Product Images

Coomassie blue staining of purified CDK7 protein (Cat# TP302736). The protein was produced from HEK293T cells transfected with CDK7 cDNA clone (Cat# RC202736) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202736
• Predicted MW: 39.1 kDa
• Protein Sequence:
  Sequence Link

  >RC202736 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELS
  HPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHRHWILHRDLKP
  NNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRV
  PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNP
  CARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001790
• RefSeq Size: 1534
• RefSeq ORF: 1038
• Synonyms: CAK; CAK1; CDKN7; HCAK; MO15; p39MO15; STK1
• Locus ID: 1022
• UniProt ID: P50613, A0A0S2Z3F9
• Cytogenetics: 5q13.2
• Summary: The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protein Kinase, Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Cell cycle, Nucleotide excision repair