SSX2 (NM_001278697) Human Tagged ORF Clone

CAT#: RG236621

  • TrueORF®

SSX2 (tGFP-tagged) - Human synovial sarcoma, X breakpoint 2 (SSX2), transcript variant 3

ORF Plasmid: DDK tGFP


  "NM_001278697" in other vectors (2)

Reconstitution Protocol

USD 530.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Anti-SSX2 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10)
    • 100 ul

USD 447.00

Other products for "SSX2"

Specifications

Product Data
Tag TurboGFP
Symbol SSX2
Synonyms CT5.2; CT5.2A; HD21; HOM-MEL-40; SSX
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG236621 representing NM_001278697.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGAACGGAGACGACGCCTTTGCAAGGAGACCCACGGTTGGTGCTCAAATACCAGAGAAGATCCAAAAG
GCCTTCGATGATATTGCCAAATACTTCTCTAAGGAAGAGTGGGAAAAGATGAAAGCCTCGGAGAAAATC
TTCTATGTGTATATGAAGAGAAAGTATGAGGCTATGACTAAACTAGGTTTCAAGGCCACCCTCCCACCT
TTCATGTGTAATAAACGGGCCGAAGACTTCCAGGGGAATGATTTGGATAATGACCCTAACCGTGGGAAT
CAGGTTGAACGTCCTCAGATGACTTTCGGCAGGCTCCAGGGAATCTCCCCGAAGATCATGCCCAAGAAG
CCAGCAGAGGAAGGAAATGATTCGGAGGAAGTGCCAGAAGCATCTGGCCCACAAAATGATGGGAAAGAG
CTGTGCCCCCCGGGAAAACCAACTACCTCTGAGAAGATTCACGAGAGATCTGGAAATAGGGAGGCCCAA
GAAAAGGAAGAGAGACGCGGAACAGCTCATCGGTGGAGCAGTCAGAACACACACAACATTGGACCCAAA
AGGGGGGAACATGCCTGGACCCACAGACTGCGTGAGAGAAAACAGCTGGTGATTTATGAAGAGATCAGC
GACCCTGAGGAAGATGACGAG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC
>Peptide sequence encoded by RG236621
Blue=ORF Red=Cloning site Green=Tag(s)

MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPP
FMCNKRAEDFQGNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKE
LCPPGKPTTSEKIHERSGNREAQEKEERRGTAHRWSSQNTHNIGPKRGEHAWTHRLRERKQLVIYEEIS
DPEEDDE

TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV
MGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVMGTGFPED
SVIFTDKIIRSNATVEHLHPMGDNDLDGSFTRTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFA
FRRVEEDHSNTELGIVEYQHAFKTPDADAGEERV

Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001278697
ORF Size 642 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reference Data
RefSeq NM_001278697.1, NP_001265626.1
RefSeq Size 1426 bp
RefSeq ORF 645 bp
Locus ID 6757
UniProt ID Q16385
Cytogenetics Xp11.22
Protein Families Druggable Genome, Transcription Factors
MW 25.1 kDa
Gene Summary The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. This gene, and also the SSX1 and SSX4 family members, have been involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are likely responsible for transforming activity. Alternative splicing of this gene results in multiple transcript variants. This gene also has an identical duplicate, GeneID: 727837, located about 45 kb downstream in the opposite orientation on chromosome X. [provided by RefSeq, Jul 2013]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.