MADH7 (SMAD7) (NM_001190823) Human Tagged ORF Clone

CAT#: RG231085

  • TrueORF®

SMAD7 (tGFP-tagged) - Human SMAD family member 7 (SMAD7), transcript variant 4

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_001190823" in other vectors (3)

Reconstitution Protocol

USD 530.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Anti-SMAD7 rabbit polyclonal antibody
    • 100 ul

USD 380.00

Other products for "MADH7"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol MADH7
Synonyms CRCS3; MADH7; MADH8
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG231085 representing NM_001190823
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGTGGTTTGTCTTTCATGCTGTTTAGAGCGTGCTTAAAGATGGATCTTGGTGTTTTTATTTGTGTAT
TTATTTCTTTCTCTCCCCTTTTCAAATCCACAGCAGACTGTCCAGATGCTGTGCCTTCCTCCGCTGAAAC
AGGGGGAACGAATTATCTGGCCCCTGGGGGGCTTTCAGATTCCCAACTTCTTCTGGAGCCTGGGGATCGG
TCACACTGGTGCGTGGTGGCATACTGGGAGGAGAAGACGAGAGTGGGGAGGCTCTACTGTGTCCAGGAGC
CCTCTCTGGATATCTTCTATGATCTACCTCAGGGGAATGGCTTTTGCCTCGGACAGCTCAATTCGGACAA
CAAGAGTCAGCTGGTGCAGAAGGTGCGGAGCAAAATCGGCTGCGGCATCCAGCTGACGCGGGAGGTGGAT
GGTGTGTGGGTGTACAACCGCAGCAGTTACCCCATCTTCATCAAGTCCGCCACACTGGACAACCCGGACT
CCAGGACGCTGTTGGTACACAAGGTGTTCCCCGGTTTCTCCATCAAGGCTTTCGACTACGAGAAGGCGTA
CAGCCTGCAGCGGCCCAATGACCACGAGTTTATGCAGCAGCCGTGGACGGGCTTTACCGTGCAGATCAGC
TTTGTGAAGGGCTGGGGCCAGTGCTACACCCGCCAGTTCATCAGCAGCTGCCCGTGCTGGCTAGAGGTCA
TCTTCAACAGCCGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG231085 representing NM_001190823
Red=Cloning site Green=Tags(s)

MCGLSFMLFRACLKMDLGVFICVFISFSPLFKSTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDR
SHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVD
GVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQIS
FVKGWGQCYTRQFISSCPCWLEVIFNSR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001190823
ORF Size 714 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001190823.1, NP_001177752.1
RefSeq Size 2386 bp
RefSeq ORF 717 bp
Locus ID 4092
UniProt ID O15105
Cytogenetics 18q21.1
Protein Families Druggable Genome, Transcription Factors
Protein Pathways TGF-beta signaling pathway
Gene Summary The protein encoded by this gene is a nuclear protein that binds the E3 ubiquitin ligase SMURF2. Upon binding, this complex translocates to the cytoplasm, where it interacts with TGF-beta receptor type-1 (TGFBR1), leading to the degradation of both the encoded protein and TGFBR1. Expression of this gene is induced by TGFBR1. Variations in this gene are a cause of susceptibility to colorectal cancer type 3 (CRCS3). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.