UQCR11 (NM_006830) Human Tagged ORF Clone
CAT#: RC201360
- TrueORF®
UQCR11 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit XI (UQCR11), nuclear gene encoding mitochondrial protein
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_006830" in other vectors (4)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | UQCR11 |
Synonyms | 0710008D09Rik; QCR10; UQCR |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC201360 representing NM_006830
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTGACCCGGTTCCTGGGCCCACGCTACCGGGAGCTGGTCAAGAACTGGGTCCCGACGGCCTACACAT GGGGCGCTGTGGGCGCCGTGGGGCTGGTGTGGGCCACCGATTGGCGGCTGATCCTGGACTGGGTACCTTA CATCAATGGCAAGTTTAAGAAGGATAAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC201360 representing NM_006830
Red=Cloning site Green=Tags(s) MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_006830 |
ORF Size | 168 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_006830.4 |
RefSeq Size | 1335 bp |
RefSeq ORF | 171 bp |
Locus ID | 10975 |
UniProt ID | O14957 |
Cytogenetics | 19p13.3 |
Protein Families | Transmembrane |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
MW | 6.6 kDa |
Gene Summary | This gene encodes the smallest known component of the ubiquinol-cytochrome c reductase complex, which forms part of the mitochondrial respiratory chain. The encoded protein may function as a binding factor for the iron-sulfur protein in this complex. [provided by RefSeq, Oct 2009] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC201360L3 | Lenti-ORF clone of UQCR11 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit XI (UQCR11), nuclear gene encoding mitochondrial protein |
USD 450.00 |
|
RC201360L4 | Lenti-ORF clone of UQCR11 (mGFP-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit XI (UQCR11), nuclear gene encoding mitochondrial protein |
USD 450.00 |
|
RG201360 | UQCR11 (tGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit XI (UQCR11), nuclear gene encoding mitochondrial protein |
USD 350.00 |
|
SC115882 | UQCR11 (untagged)-Human ubiquinol-cytochrome c reductase, complex III subunit XI (UQCR11), nuclear gene encoding mitochondrial protein |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review