Aire (NM_001271557) Mouse Tagged ORF Clone

CAT#: MR229752

  • TrueORF®

Aire (myc-DDK-tagged) - Mouse autoimmune regulator (autoimmune polyendocrinopathy candidiasis ectodermal dystrophy) (Aire), transcript variant 10


  "NM_001271557" in other vectors (1)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 503.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


AIRE Antibody - N-terminal region
    • 100 ul

USD 539.00

Other products for "Aire"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Aire
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR229752 representing NM_001271557
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGGTGGGGATGGAATGCTACGCCGTCTGCTGAGGCTGCACCGCACCGAGATCGCGGTGGCCATAG
ACAGTGCCTTTCCGCTGCTGCATGCTCTAGCCGACCACGACGTGGTCCCTGAGGACAAGTTCCAGGAGAC
GCTCCGTCTGAAGGAGAAGGAAGGCTGCCCCCAGGCCTTCCACGCCCTGCTGTCCTGGCTCCTGACCCGG
GACAGTGGGGCCATCCTGGATTTCTGGAGGATTCTCTTTAAGGACTACAATCTGGAGCGGTACAGCCGCC
TGCATAGCATCCTGGACGGCTTCCCAAAAGATGTGGACCTAAACCAGTCCCGGAAAGGGAGAAAGCCCCT
TGCTGGTCCCAAGGCCGCGGTACTGCCACCCAGACCCCCCACCAAGAGAAAAGCACTGGAGGAGCCTCGA
GCCACCCCACCAGCAACTCTGGCCTCAAAGAGCGTCTCCAGCCCAGGCTCCCACCTGAAGACTAAGCCCC
CTAAGAAGCCAGATGGCAACTTGGAGTCACAGCACCTTCCTCTTGGAAACGGAATTCAGACCATGGCAGC
TTCTGTCCAGAGAGCTGTGACCGTGGCCTCTGGGGATGTTCCAGGAACCCGAGGGGCCGTGGAAGGGATC
CTTATCCAGCAGGTGTTTGAGTCAGGAAGATCCAAGAAGTGCATTCAGGTTGGGGGAGAGTTTTATACAC
CCAACAAGTTCGAAGACCCCAGTGGCAATTTGAAGAACAAGGCCCGGAGTGGTAGCAGCCTAAAGCCAGT
GGTCCGAGCCAAGGGAGCCCAGGTCACTATACCTGGTAGAGATGAGCAGAAAGTGGGCCAGCAGTGTGGG
GTTCCTCCCCTTCCATCCCTCCCCAGTGAGCCCCAGGTTAACCAGAACGAGGATGAGTGTGCCGTGTGCC
ACGACGGAGGTGAGCTCATCTGTTGTGACGGCTGTCCCCGGGCCTTCCACCTGGCTTGCCTGTCCCCACC
TCTGCAGGAGATCCCCAGTGGCCTCTGGAGATGCTCCTGCTGCCTCCAGGGCAGAGTCCAACAGAACCTG
TCCCAGCCTGAGGTGTCCAGGCCCCCGGAGCTACCTGCAGAGACCCCGGACCAATCTCCGCTGCAAATCC
TGCTCTGCAGACTCGACTCCCACGCCAGGCACACCGGGCGAAGCTGTACCCACCTCTGGGCCCCGTCCAG
CACCTGGGCTTGCCAAGGTAGGGGACGACTCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR229752 representing NM_001271557
Red=Cloning site Green=Tags(s)

MAGGDGMLRRLLRLHRTEIAVAIDSAFPLLHALADHDVVPEDKFQETLRLKEKEGCPQAFHALLSWLLTR
DSGAILDFWRILFKDYNLERYSRLHSILDGFPKDVDLNQSRKGRKPLAGPKAAVLPPRPPTKRKALEEPR
ATPPATLASKSVSSPGSHLKTKPPKKPDGNLESQHLPLGNGIQTMAASVQRAVTVASGDVPGTRGAVEGI
LIQQVFESGRSKKCIQVGGEFYTPNKFEDPSGNLKNKARSGSSLKPVVRAKGAQVTIPGRDEQKVGQQCG
VPPLPSLPSEPQVNQNEDECAVCHDGGELICCDGCPRAFHLACLSPPLQEIPSGLWRCSCCLQGRVQQNL
SQPEVSRPPELPAETPDQSPLQILLCRLDSHARHTGRSCTHLWAPSSTWACQGRGRLC

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001271557
ORF Size 1224 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001271557.1, NP_001258486.1
RefSeq Size 1691 bp
RefSeq ORF 1227 bp
Locus ID 11634
UniProt ID Q9Z0E3
Cytogenetics 10 39.72 cM
MW 44.9 kDa
Gene Summary Transcription factor playing an essential role to promote self-tolerance in the thymus by regulating the expression of a wide array of self-antigens that have the commonality of being tissue-restricted in their expression pattern in the periphery, called tissue restricted antigens (TRA) (Probable). Binds to G-doublets in an A/T-rich environment; the preferred motif is a tandem repeat of 5'-. ATTGGTTA-3' combined with a 5'-TTATTA-3' box. Binds to nucleosomes (By similarity). Binds to chromatin and interacts selectively with histone H3 that is not methylated at 'Lys-4', not phosphorylated at 'Thr-3' and not methylated at 'Arg-2'. Functions as a sensor of histone H3 modifications that are important for the epigenetic regulation of gene expression. Mainly expressed by medullary thymic epithelial cells (mTECs), induces the expression of thousands of tissue-restricted proteins, which are presented on major histocompatibility complex class I (MHC-I) and MHC-II molecules to developing T-cells percolating through the thymic medulla (By similarity). Also induces self-tolerance through other mechanisms such as the regulation of the mTEC differentiation program (PubMed:19015306). Controls the medullary accumulation of thymic dendritic cells and the development of regulatory T-cell through the regulation of XCL1 expression (PubMed:21300913). Regulates the production of CCR4 and CCR7 ligands in medullary thymic epithelial cells and alters the coordinated maturation and migration of thymocytes (PubMed:19923453). In thimic B-cells, allows the presentation of licensing-dependent endogenous self-anitgen for negative selection (PubMed:26070482). In secondary lymphoid organs, induces functional inactivation of CD4(+) T-cells. Expressed by a distinct bone marrow-derived population, induces self-tolerance through a mechanism that does not require regulatory T-cells and is resitant to innate inflammatory stimuli (PubMed:23993652).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.