Human OAZ1 (NM_004152) AAV Particle

CAT#: RC223468A1V

  • AAV ORF®

AAV ORF Particles, serotype AAV-2, OAZ1 (Myc-DDK-tagged)-Human ornithine decarboxylase antizyme 1 (OAZ1), 250ul, >10^13 GC/mL

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro



Customize this AAV Particle

Available in AAV1, AAV3, AAV5, AAV6, AAV7, AAV8, AAV9, AAVrh.10, AAVDJ, AAV-PHP.eb
Other Tag Options: GFP, RFP

USD 850.00

4 Weeks*

Size
    • 250 ul

Product Images

Frequently bought together (2)
AAV2 with CMV promoter-driven expression of GFP, >10^13 GC/mL, 50 ul
    • 50 ul

USD 427.00


pAAV-AC-Myc-DDK, AAV vector with C-terminal Myc-DDK tag
    • 10 ug

USD 850.00

Other products for "OAZ1"

Specifications

Product Data
Tag Myc-DDK
Symbol OAZ1
Synonyms AZ1; AZI; OAZ
Vector pAAV-AC-Myc-DDK
Mammalian Cell Selection None
Sequence Data
>RC223468 representing NM_004152
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

GTGAAATCCTCCCTGCAGCGGATCCTCAATAGCCACTGCTTCGCCAGAGAGAAGGAAGGGGATAAACCCA
GCGCCACCATCCACGCCAGCCGCACCATGCCGCTCCTTAGCCTGCACAGCCGCGGCGGCAGCAGCAGTGA
GAGTTCCAGGGTCTCCCTCCACTGCTGTAGTAACCCGGGTCCGGGGCCTCGGTGGTGCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223468 representing NM_004152
Red=Cloning site Green=Tags(s)

VKSSLQRILNSHCFAREKEGDKPSATIHASRTMPLLSLHSRGGSSSESSRVSLHCCSNPGPGPRWCS

myc-FLAG tag
Species Human
Serotype AAV-2
ACCN NM_004152
ORF Size 201 bp
Storage Buffer PBS with 0.001% Pluronic F68
Stability AAV is stable for 1 year when stored at -80°C (long-term storage) or 2-3 weeks when stored at -20°C (short-term storage). Thaw the vial of AAV on ice prior to use and keep it on ice during the experiment. Thawed AAV can be stored at 4°C for 1-2 weeks. Whenever possible, particles should be aliquoted into single use portions to avoid repeated freeze/thaw cycles. Please aliquot at least 10ul per tube and use low protein binding tubes to avoid loss of virus.
Reference Data
RefSeq NM_004152.1
RefSeq Size 986 bp
RefSeq ORF 688 bp
Locus ID 4946
UniProt ID P54368
Cytogenetics 19p13.3
MW 7.22 kDa

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.