CNDP1 Rabbit Polyclonal Antibody

CAT#: TA343002

Rabbit Polyclonal Anti-CNDP1 Antibody

Product Images

WB Suggested Anti-CNDP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CNDP1 antibody: synthetic peptide directed towards the C terminal of human CNDP1. Synthetic peptide located within the following region: GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: carnosine dipeptidase 1
• Database Link:
  NP_116038
  Entrez Gene 84735 Human
  UniProt ID Q96KN2
• Background: CNDP1 is a member of the M20 metalloprotease family. The protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. CNDP1 gene contains trinucleotide (CTG) repeat length polymorphism in the coding region.
• Synonyms: CN1; CPGL2; HsT2308
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Guinea pig

Reference Data

• Protein Families: Protease, Secreted Protein
• Protein Pathways: beta-Alanine metabolism, Histidine metabolism, Metabolic pathways