Calbindin (CALB1) Rabbit Polyclonal Antibody

CAT#: TA342845

Rabbit Polyclonal Anti-CALB1 Antibody

Product Images

CALB1 antibody validated by WB using COLO205 cells lysate at 1 ug/ml.

• 

  CALB1 Antibody tested with human purkinje fibers in Immunohistochemistry

• 

  Primary Antibody Dilution: 1:500 Secondary Antibody: Donkey anti-rabbit Alexa 488 Secondary Antibody Dilution: 1:500 Gene Name: CALB1 Submitted by :Anonymous

• 

  Primary Antibody Dilution: 1:500 Secondary Antibody: Donkey anti-rabbit Alexa 488 Secondary Antibody Dilution: 1:500 Gene Name: CALB1

• 

  Species+tissue/cell type: Tadpole forebrain horizontal section; Primary antibody dilution: 1:500; Secondary antibody: Donkey anti-rabbit Alexa 488; Secondary antibody dilution: 1:500

• 

  Application: IHC; Species+tissue/cell type: Tadpole tegmenta horizontal section; Primary antibody dilution: 1:500; Secondary antibody: Donkey anti-rabbit Alexa 488; Secondary antibody dilution: 1:500

Show all 6 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Tadpole
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CALB1 antibody: synthetic peptide directed towards the C terminal of human CALB1. Synthetic peptide located within the following region: EFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: calbindin 1
• Database Link:
  NP_004920
  Entrez Gene 793 Human
  UniProt ID P05937
• Background: Calbindin is a calcium-binding protein belonging to the troponin C superfamily. It was originally described as a 27-kD protein induced by vitamin D in the duodenum of the chick. In the brain, its synthesis is independent of vitamin-D-derived hormones. Calbindin contains 4 active calcium-binding domains, and 2 modified domains that presumably have lost their calcium-binding capacity. The neurons in brains of patients with Huntington disease are calbindin-depleted.
• Synonyms: CALB; D-28K
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%