Cryptochrome I (CRY1) Rabbit Polyclonal Antibody

CAT#: TA342728

Rabbit Polyclonal Anti-CRY1 Antibody

Product Images

Host: Rabbit; Target Name: CRY1; Sample Tissue: Hela Whole cell; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:1 ug/ml; Peptide Concentration: 5ug/ml; Lysate Quantity: 25ug/lane; Gel Concentration: 0.

• 

  Immunohistochemistry with Testis tissue at an antibody concentration of 5 ug/ml using anti-CRY1 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: cryptochrome circadian clock 1
• Database Link:
  NP_004066
  Entrez Gene 1407 Human
  UniProt ID Q16526
• Background: CRY1 is the blue light-dependent regulator of the circadian feedback loop. CRY1 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. CRY1 has no photolyase activity. CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. CRY1 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
• Synonyms: PHLL1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Circadian rhythm - mammal