EGLN2 Rabbit Polyclonal Antibody
USD 200.00
USD 867.00
USD 436.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-EGLN2 Antibody: synthetic peptide directed towards the N terminal of human EGLN2. Synthetic peptide located within the following region: SAGSGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 44 kDa |
Gene Name | egl-9 family hypoxia inducible factor 2 |
Database Link | |
Background | The hypoxia inducible factor (HIF) is a transcriptional complex which is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. EGLN2 encodes an enzyme responsible for this posttranslational modification. Alternative splicing of EGLN2 results in three transcript variants encoding different isoforms. |
Synonyms | EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 86%; Bovine: 79%; Rabbit: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Pathways in cancer, Renal cell carcinoma |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review