Cyclophilin A (PPIA) Rabbit Polyclonal Antibody

CAT#: TA331802

Rabbit Polyclonal Anti-PPIA Antibody

Product Images

Host: Rabbit; Target Name: PPIA; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PPIA Antibody is: synthetic peptide directed towards the middle region of Human PPIA. Synthetic peptide located within the following region: NGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: peptidylprolyl isomerase A
• Database Link:
  NP_066953
  Entrez Gene 5478 Human
  UniProt ID P62937
• Background: PPIA is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. PPIA is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.
• Synonyms: CYPA; CYPH; HEL-S-69p
• Note: Immunogen sequence homology: Human: 100%; Yeast: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Goat: 92%; Horse: 92%; Sheep: 92%; Bovine: 92%; Guinea pig: 92%; Mouse: 83%