Products

cDNA Clones (11)
Gene Expression (5)
Proteins (4)
Antibodies (3)
Jump to Filters
View as table Download
GERP (TRIM8) (NM_030912) Human Tagged ORF Clone
RC205812

USD 769.00

In Stock

TRIM8 (Myc-DDK-tagged)-Human tripartite motif containing 8 (TRIM8)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GERP (TRIM8) (NM_030912) Human Tagged ORF Clone
RG205812

USD 969.00

In Stock

TRIM8 (tGFP-tagged) - Human tripartite motif containing 8 (TRIM8)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GERP (TRIM8) (NM_030912) Human Recombinant Protein
TP305812

USD 867.00

4 Weeks

Recombinant protein of human tripartite motif-containing 8 (TRIM8), 20 µg

Tag C-Myc/DDK
Expression Host HEK293T
GERP (TRIM8) Human Gene Knockout Kit (CRISPR)
KN405812

USD 1,657.00

2 Weeks

TRIM8 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
GERP (TRIM8) (NM_030912) Human Recombinant Protein
TP305812L

USD 9,200.00

6 Weeks

Recombinant protein of human tripartite motif-containing 8 (TRIM8), 1 mg

Tag C-Myc/DDK
Expression Host HEK293T
GERP (TRIM8) (NM_030912) Human Recombinant Protein
TP305812M

USD 2,950.00

6 Weeks

Recombinant protein of human tripartite motif-containing 8 (TRIM8), 100 µg

Tag C-Myc/DDK
Expression Host HEK293T
GERP (TRIM8) Rabbit Polyclonal Antibody
TA345418

USD 539.00

5 Days

Rabbit Polyclonal Anti-TRIM8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM8 antibody: synthetic peptide directed towards the N terminal of human TRIM8. Synthetic peptide located within the following region: RGCIGEAWAKDSGLVRCPECNQAYNQKPGLEKNLKLTNIVEKFNALHVEK
GERP (TRIM8) Goat Polyclonal Antibody
TA311537

USD 520.00

5 Days

Goat Anti-GERP / TRIM8 Antibody

Applications FC, IF, IHC, PEP-ELISA
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence C-YGQPSTKHYVTS, from the C Terminus of the protein sequence according to NP_112174.2.
GERP (TRIM8) (NM_030912) Human Tagged ORF Clone Lentiviral Particle
RC205812L2V

USD 1,319.00

2 Weeks

Lenti ORF particles, TRIM8 (mGFP-tagged) - Human tripartite motif containing 8 (TRIM8), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GERP (TRIM8) (NM_030912) Human Tagged Lenti ORF Clone
RC205812L4

USD 1,069.00

3 Weeks

Lenti ORF clone of Human tripartite motif containing 8 (TRIM8), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GERP (TRIM8) (NM_030912) Human Tagged ORF Clone Lentiviral Particle
RC205812L1V

USD 1,319.00

2 Weeks

Lenti ORF particles, TRIM8 (Myc-DDK tagged) - Human tripartite motif containing 8 (TRIM8), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®