SLC1A2 (Myc-DDK-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
SLC1A2 (Myc-DDK-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SLC1A2 (tGFP-tagged) - Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SLC1A2 (Myc-DDK-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SLC1A2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
SLC1A2 (Myc-DDK tagged) - Homo sapiens solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SLC1A2 (tGFP-tagged) - Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SLC1A2 (tGFP-tagged) - Homo sapiens solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-SLC1A2 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC1A2 antibody: synthetic peptide directed towards the N terminal of human SLC1A2. Synthetic peptide located within the following region: PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK |
Anti-SLC1A2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 556-574 amino acids of human solute carrier family 1 (glial high affinity glutamate transporter), member 2 |
Lenti-ORF clone of SLC1A2 (mGFP-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of SLC1A2 (Myc-DDK-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 2
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of SLC1A2 (Myc-DDK-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,405.00
2 Weeks
Lenti ORF particles, SLC1A2 (mGFP-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti-ORF clone of SLC1A2 (mGFP-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 2 (SLC1A2), transcript variant 2
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-SLC1A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC1A2 antibody: synthetic peptide directed towards the middle region of human SLC1A2. Synthetic peptide located within the following region: LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEM |