Products

View as table Download

Rabbit Polyclonal Anti-SLC1A2 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC1A2 antibody: synthetic peptide directed towards the N terminal of human SLC1A2. Synthetic peptide located within the following region: PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK

Anti-SLC1A2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 556-574 amino acids of human solute carrier family 1 (glial high affinity glutamate transporter), member 2

Rabbit Polyclonal Anti-SLC1A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC1A2 antibody: synthetic peptide directed towards the middle region of human SLC1A2. Synthetic peptide located within the following region: LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEM