USD 550.00
5 Days
Mouse Monoclonal DNA Polymerase epsilon Antibody (3C5.1)
Applications | IHC, IP, WB |
Reactivities | Drosophila, Human, Mouse, Primate |
Conjugation | Unconjugated |
USD 550.00
5 Days
Mouse Monoclonal DNA Polymerase epsilon Antibody (3C5.1)
Applications | IHC, IP, WB |
Reactivities | Drosophila, Human, Mouse, Primate |
Conjugation | Unconjugated |
Rabbit polyclonal POLE3 Antibody (N-term)
Applications | FC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | This POLE3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 5-34 amino acids from the N-terminal region of human POLE3. |
Rabbit Polyclonal Anti-POLE3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-POLE3 Antibody: synthetic peptide directed towards the N terminal of human POLE3. Synthetic peptide located within the following region: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATS |
Rabbit Polyclonal Anti-POLE3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLE3 antibody: synthetic peptide directed towards the N terminal of human POLE3. Synthetic peptide located within the following region: AERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSC |