Products

Jump to Filters
View as table Download
DAZAP2 (C-term) Rabbit Polyclonal Antibody
AP51189PU-N

USD 580.00

2 Weeks

DAZAP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 118~147 amino acids from the C-terminal region of Human DAZAP2.
DAZAP2 Rabbit Polyclonal Antibody
TA331247

USD 539.00

5 Days

Rabbit Polyclonal Anti-DAZAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DAZAP2 antibody is: synthetic peptide directed towards the C-terminal region of Human DAZAP2. Synthetic peptide located within the following region: AGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTI