Rabbit Polyclonal Anti-CD200 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD200 antibody is: synthetic peptide directed towards the C-terminal region of Human CD200. Synthetic peptide located within the following region: GTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP |
Rabbit Polyclonal Anti-CD200 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD200 antibody is: synthetic peptide directed towards the C-terminal region of Human CD200. Synthetic peptide located within the following region: PRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTD |
Anti-CD200 Reference Antibody (samalizumab)
| Applications | Animal Model, ELISA, FACS, FN, Kinetics |
| Reactivities | Human, Mouse, Cynomolgus |
| Conjugation | Unconjugated |
CD200 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CD200 |
CD200 mouse monoclonal antibody, clone OX-104, Purified
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-CD200 antibody(DM156), Rabbit mAb
| Applications | ELISA, FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD200 mouse monoclonal antibody, clone OX-104, Purified
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD200 mouse monoclonal antibody, clone OX-104, Purified
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD200 mouse monoclonal antibody, clone OX-104, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD200 mouse monoclonal antibody, clone OX-104, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD200 mouse monoclonal antibody, clone OX-104, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
Human CD200 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human CD200 |
| Reactivities | Human |
Germany
Japan
United Kingdom
China
