Products

cDNA Clones (7)
Antibodies (3)
Jump to Filters
View as table Download
DMGDH (NM_013391) Human Tagged ORF Clone
RC223089

USD 793.00

In Stock

DMGDH (Myc-DDK-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DMGDH (NM_013391) Human Tagged ORF Clone
RG223089

USD 993.00

3 Weeks

DMGDH (tGFP-tagged) - Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DMGDH (NM_013391) Human Tagged Lenti ORF Clone
RC223089L3

USD 1,093.00

3 Weeks

Lenti-ORF clone of DMGDH (Myc-DDK-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DMGDH (NM_013391) Human Tagged Lenti ORF Clone
RC223089L4

USD 1,093.00

3 Weeks

Lenti-ORF clone of DMGDH (mGFP-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DMGDH Rabbit Polyclonal Antibody
TA315405

USD 380.00

In Stock

Rabbit polyclonal anti-DMGDH antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human DMGDH.
DMGDH (NM_013391) Human Tagged ORF Clone Lentiviral Particle
RC223089L3V

USD 1,343.00

5 Weeks

Lenti ORF particles, DMGDH (Myc-DDK-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DMGDH (NM_013391) Human Tagged ORF Clone Lentiviral Particle
RC223089L4V

USD 1,343.00

5 Weeks

Lenti ORF particles, DMGDH (mGFP-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DMGDH Rabbit Polyclonal Antibody
TA338400

USD 539.00

5 Days

Rabbit Polyclonal Anti-Dmgdh Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dmgdh antibody is: synthetic peptide directed towards the middle region of Mouse Dmgdh. Synthetic peptide located within the following region: SELHDLRWIEEAAFRGGYDVEIQNITDEFGVLGVAGPYARRVLQKLTSE
DMGDH Rabbit Polyclonal Antibody
TA358745

USD 539.00

5 Days

DMGDH Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
DMGDH (NM_013391) Human Untagged Clone
SC124128

USD 794.00

In Stock

DMGDH (untagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None