Germany
Japan
United Kingdom
China
TCF7L1 (Myc-DDK-tagged)-Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table Download
TCF7L1 (tGFP-tagged) - Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-TCF7L1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG |
Rabbit Polyclonal anti-TCF7L1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: NDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESENQSSSSDSEA |
Lenti-ORF clone of TCF7L1 (mGFP-tagged)-Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
TCF7L1 (untagged)-Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-TCF7L1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TCF7L1. |
Lenti ORF particles, TCF7L1 (Myc-DDK-tagged)-Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, TCF7L1 (mGFP-tagged)-Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of TCF7L1 (Myc-DDK-tagged)-Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Active filters
Target Symbol
- TCF7L1
Pathways
- Thyroid cancer