TCF7L1 (Myc-DDK-tagged)-Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7L1 (Myc-DDK-tagged)-Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TCF7L1 (tGFP-tagged) - Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-TCF7L1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG |
Rabbit Polyclonal anti-TCF7L1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: NDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESENQSSSSDSEA |
Lenti-ORF clone of TCF7L1 (mGFP-tagged)-Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TCF7L1 (untagged)-Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-TCF7L1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TCF7L1. |
Lenti ORF particles, TCF7L1 (Myc-DDK-tagged)-Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TCF7L1 (mGFP-tagged)-Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TCF7L1 (Myc-DDK-tagged)-Human transcription factor 7-like 1 (T-cell specific, HMG-box) (TCF7L1)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |