PRIM1 (Myc-DDK-tagged)-Human primase, DNA, polypeptide 1 (49kDa) (PRIM1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRIM1 (Myc-DDK-tagged)-Human primase, DNA, polypeptide 1 (49kDa) (PRIM1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PRIM1 (Myc-DDK tagged) - Human primase, DNA, polypeptide 1 (49kDa) (PRIM1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PRIM1 (mGFP-tagged) - Human primase, DNA, polypeptide 1 (49kDa) (PRIM1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PRIM1 (tGFP-tagged) - Human primase, DNA, polypeptide 1 (49kDa) (PRIM1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PRIM1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Lenti ORF clone of Human primase, DNA, polypeptide 1 (49kDa) (PRIM1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit polyclonal anti-PRIM1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human PRIM1. |
PRIM1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of primase, DNA, polypeptide 1 (49kDa) (PRIM1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-PRIM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRIM1 antibody: synthetic peptide directed towards the N terminal of human PRIM1. Synthetic peptide located within the following region: SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM |
Lenti ORF clone of Human primase, DNA, polypeptide 1 (49kDa) (PRIM1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
PRIM1 (untagged)-Human primase, DNA, polypeptide 1 (49kDa) (PRIM1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |