Products

View as table Download

PRIM1 (Myc-DDK-tagged)-Human primase, DNA, polypeptide 1 (49kDa) (PRIM1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, PRIM1 (Myc-DDK tagged) - Human primase, DNA, polypeptide 1 (49kDa) (PRIM1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PRIM1 (mGFP-tagged) - Human primase, DNA, polypeptide 1 (49kDa) (PRIM1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PRIM1 (tGFP-tagged) - Human primase, DNA, polypeptide 1 (49kDa) (PRIM1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PRIM1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Lenti ORF clone of Human primase, DNA, polypeptide 1 (49kDa) (PRIM1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit polyclonal anti-PRIM1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human PRIM1.

PRIM1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of primase, DNA, polypeptide 1 (49kDa) (PRIM1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-PRIM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRIM1 antibody: synthetic peptide directed towards the N terminal of human PRIM1. Synthetic peptide located within the following region: SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM

Lenti ORF clone of Human primase, DNA, polypeptide 1 (49kDa) (PRIM1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

PRIM1 (untagged)-Human primase, DNA, polypeptide 1 (49kDa) (PRIM1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

USD 1,174.00

4 Weeks

Transient overexpression of PRIM1 in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Applications IHC
Other Names p49
Accession Number NM_000946, NP_000937