Products

View as table Download

LCLAT1 (Myc-DDK-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, LCLAT1 (mGFP-tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, LCLAT1 (Myc-DDK tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, LCLAT1 (Myc-DDK tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, LCLAT1 (mGFP-tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

LCLAT1 (tGFP-tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

LCLAT1 (Myc-DDK-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

LCLAT1 (tGFP-tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-LYCAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE

LCLAT1 (untagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression lysate of lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti-ORF clone of LCLAT1 (Myc-DDK-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®