Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15), 20 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
UGT2B15 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15), 1 mg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15), 100 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
UGT2B15 (tGFP-tagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of UGT2B15 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
Lenti-ORF clone of UGT2B15 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
Lenti-ORF clone of UGT2B15 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of UGT2B15 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UGT2B15 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
Lenti ORF particles, UGT2B15 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
Lenti ORF particles, UGT2B15 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UGT2B15 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-UGT2B15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UGT2B15 antibody: synthetic peptide directed towards the N terminal of human UGT2B15. Synthetic peptide located within the following region: IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY |
Germany
Japan
United Kingdom
China
