UGT1A4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
UGT1A4 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), 1 mg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), 100 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
UGT1A4 (tGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
UGT1A4 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF particles, UGT1A4 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UGT1A4 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-UGT1A4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A4 antibody: synthetic peptide directed towards the N terminal of human UGT1A4. Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK |
Transient overexpression lysate of UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit anti-UGT1A4 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A4 |
UGT1A4 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A4 |
UGT1A4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
UGT1A4 MS Standard C13 and N15-labeled recombinant protein (NP_009051)
Tag | C-Myc/DDK |
Expression Host | HEK293 |