Products

cDNA Clones (12)
Proteins (7)
Antibodies (2)
Jump to Filters
View as table Download
Apc7 (ANAPC7) (NM_016238) Human Tagged ORF Clone
RC219871

USD 526.00

5 Days

ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc7 (ANAPC7) (NM_001137664) Human Tagged ORF Clone
RC227559

USD 500.00

In Stock

ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc7 (ANAPC7) (NM_016238) Human Tagged ORF Clone
RG219871

USD 726.00

3 Weeks

ANAPC7 (tGFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc7 (ANAPC7) (NM_001137664) Human Tagged ORF Clone
RG227559

USD 700.00

3 Weeks

ANAPC7 (tGFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Apc7 (ANAPC7) Rabbit Polyclonal Antibody
TA319926

USD 570.00

5 Days

Rabbit Polyclonal APC7 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC7 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human APC7.
Apc7 (ANAPC7) Rabbit Polyclonal Antibody
TA346133

USD 539.00

5 Days

Rabbit Polyclonal Anti-ANAPC7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS
Apc7 (ANAPC7) (NM_016238) Human Tagged Lenti ORF Clone
RC219871L4

USD 826.00

4 Weeks

Lenti ORF clone of Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc7 (ANAPC7) (NM_001137664) Human Tagged Lenti ORF Clone
RC227559L3

USD 800.00

3 Weeks

Lenti-ORF clone of ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc7 (ANAPC7) (NM_001137664) Human Tagged Lenti ORF Clone
RC227559L4

USD 800.00

3 Weeks

Lenti-ORF clone of ANAPC7 (mGFP-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc7 (ANAPC7) (NM_016238) Human Over-expression Lysate
LC414102

USD 206.00

In Stock

ANAPC7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Apc7 (ANAPC7) (NM_016238) Human Tagged ORF Clone Lentiviral Particle
RC219871L3V

USD 1,076.00

6 Weeks

Lenti ORF particles, ANAPC7 (Myc-DDK tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Apc7 (ANAPC7) (NM_016238) Human Tagged ORF Clone Lentiviral Particle
RC219871L4V

USD 1,076.00

6 Weeks

Lenti ORF particles, ANAPC7 (mGFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®