ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, 1 mg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, 100 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ANAPC7 (tGFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ANAPC7 (tGFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal APC7 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APC7 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human APC7. |
Rabbit Polyclonal Anti-ANAPC7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |
Lenti ORF clone of Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ANAPC7 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ANAPC7 (mGFP-tagged)-Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ANAPC7 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 1,076.00
6 Weeks
Lenti ORF particles, ANAPC7 (Myc-DDK tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,076.00
6 Weeks
Lenti ORF particles, ANAPC7 (mGFP-tagged) - Human anaphase promoting complex subunit 7 (ANAPC7), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |