Products

cDNA Clones (12)
Proteins (4)
Antibodies (3)
Jump to Filters
View as table Download
ADCY2 (NM_020546) Human Tagged ORF Clone
RC222444

USD 950.00

In Stock

ADCY2 (Myc-DDK-tagged)-Human adenylate cyclase 2 (brain) (ADCY2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ADCY2 (NM_020546) Human Tagged ORF Clone Lentiviral Particle
RC222444L1V

USD 1,500.00

2 Weeks

Lenti ORF particles, ADCY2 (Myc-DDK tagged) - Human adenylate cyclase 2 (brain) (ADCY2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ADCY2 (NM_020546) Human Tagged ORF Clone Lentiviral Particle
RC222444L2V

USD 1,500.00

5 Weeks

Lenti ORF particles, ADCY2 (mGFP-tagged) - Human adenylate cyclase 2 (brain) (ADCY2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ADCY2 (NM_020546) Human Tagged ORF Clone Lentiviral Particle
RC222444L4V

USD 1,500.00

5 Weeks

Lenti ORF particles, ADCY2 (mGFP-tagged) - Human adenylate cyclase 2 (brain) (ADCY2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ADCY2 (NM_020546) Human Tagged ORF Clone
RG222444

USD 1,150.00

In Stock

ADCY2 (tGFP-tagged) - Human adenylate cyclase 2 (brain) (ADCY2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ADCY2 (NM_020546) Human Tagged Lenti ORF Clone
RC222444L1

USD 1,250.00

In Stock

Lenti ORF clone of Human adenylate cyclase 2 (brain) (ADCY2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ADCY2 (NM_020546) Human Over-expression Lysate
LY412417

USD 436.00

In Stock

Transient overexpression lysate of adenylate cyclase 2 (brain) (ADCY2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ADCY2 (NM_020546) Human Tagged Lenti ORF Clone
RC222444L2

USD 1,250.00

3 Weeks

Lenti ORF clone of Human adenylate cyclase 2 (brain) (ADCY2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ADCY2 (NM_020546) Human Tagged Lenti ORF Clone
RC222444L4

USD 1,250.00

3 Weeks

Lenti ORF clone of Human adenylate cyclase 2 (brain) (ADCY2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ADCY2 (NM_020546) Human Recombinant Protein
TP762336

USD 249.00

In Stock

Purified recombinant protein of Human adenylate cyclase 2 (brain) (ADCY2), Arg822-End, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
ADCY2 (Center) Rabbit Polyclonal Antibody
AP50086PU-N

USD 580.00

2 Weeks

ADCY2 (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 458-489 amino acids from the Central region of human ADCY2
ADCY2 (NM_020546) Human Over-expression Lysate
LC412417

USD 134.00

In Stock

ADCY2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ADCY2 Rabbit Polyclonal Antibody
TA310096

USD 360.00

3 Weeks

Rabbit anti-ADCY2 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH
ADCY2 Rabbit Polyclonal Antibody
TA338425

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ADCY2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADCY2 antibody: synthetic peptide directed towards the middle region of human ADCY2. Synthetic peptide located within the following region: FLSDSEETIPPTANTTNTSFSASNNQVAILRAQNLFFLPYFIYSCILGLI