Products

cDNA Clones (7)
Proteins (3)
Antibodies (2)
Jump to Filters
View as table Download
OR6N2 (NM_001005278) Human Tagged ORF Clone
RC218173

USD 300.00

In Stock

OR6N2 (Myc-DDK-tagged)-Human olfactory receptor, family 6, subfamily N, member 2 (OR6N2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
OR6N2 (NM_001005278) Human Tagged ORF Clone Lentiviral Particle
RC218173L3V

USD 850.00

5 Weeks

Lenti ORF particles, OR6N2 (Myc-DDK tagged) - Human olfactory receptor, family 6, subfamily N, member 2 (OR6N2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OR6N2 (NM_001005278) Human Tagged ORF Clone Lentiviral Particle
RC218173L4V

USD 850.00

5 Weeks

Lenti ORF particles, OR6N2 (mGFP-tagged) - Human olfactory receptor, family 6, subfamily N, member 2 (OR6N2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OR6N2 (NM_001005278) Human Tagged ORF Clone
RG218173

USD 500.00

3 Weeks

OR6N2 (tGFP-tagged) - Human olfactory receptor, family 6, subfamily N, member 2 (OR6N2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OR6N2 (NM_001005278) Human Tagged Lenti ORF Clone
RC218173L3

USD 600.00

3 Weeks

Lenti ORF clone of Human olfactory receptor, family 6, subfamily N, member 2 (OR6N2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OR6N2 (NM_001005278) Human Tagged Lenti ORF Clone
RC218173L4

USD 600.00

3 Weeks

Lenti ORF clone of Human olfactory receptor, family 6, subfamily N, member 2 (OR6N2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OR6N2 (C-term) Rabbit Polyclonal Antibody
AP53098PU-N

USD 580.00

2 Weeks

OR6N2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 251-281 amino acids from the C-terminal region of human Olfactory receptor 6N2
OR6N2 Rabbit Polyclonal Antibody
TA337540

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR6N2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR6N2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6N2. Synthetic peptide located within the following region: KSYSLTLDRTLAIVYSVLTPMVNPIIYSLRNKEIIKAIKRTIFQKGDKAS
OR6N2 (NM_001005278) Human Over-expression Lysate
LC423837

USD 134.00

2 Weeks

OR6N2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OR6N2 (NM_001005278) Human Untagged Clone
SC300883

USD 330.00

2 Weeks

OR6N2 (untagged)-Human olfactory receptor, family 6, subfamily N, member 2 (OR6N2)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
OR6N2 CytoSection
TS418173P5

USD 1,174.00

4 Weeks

Transient overexpression of OR6N2 in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Applications IHC
Other Names OR1-23
Accession Number NM_001005278, NP_001005278