Products

cDNA Clones (7)
Antibodies (3)
Proteins (3)
Jump to Filters
View as table Download
OR4A47 (NM_001005512) Human Tagged ORF Clone
RC211764

USD 300.00

In Stock

OR4A47 (Myc-DDK-tagged)-Human olfactory receptor, family 4, subfamily A, member 47 (OR4A47)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
OR4A47 (NM_001005512) Human Tagged ORF Clone Lentiviral Particle
RC211764L3V

USD 850.00

5 Weeks

Lenti ORF particles, OR4A47 (Myc-DDK tagged) - Human olfactory receptor, family 4, subfamily A, member 47 (OR4A47), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OR4A47 (NM_001005512) Human Tagged ORF Clone Lentiviral Particle
RC211764L4V

USD 850.00

5 Weeks

Lenti ORF particles, OR4A47 (mGFP-tagged) - Human olfactory receptor, family 4, subfamily A, member 47 (OR4A47), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OR4A47 (NM_001005512) Human Tagged ORF Clone
RG211764

USD 500.00

3 Weeks

OR4A47 (tGFP-tagged) - Human olfactory receptor, family 4, subfamily A, member 47 (OR4A47)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OR4A47 Rabbit Polyclonal Antibody
TA312150

USD 380.00

4 Weeks

Rabbit polyclonal OR4A4/4A47 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR4A4/4A47.
OR4A47 (NM_001005512) Human Tagged Lenti ORF Clone
RC211764L3

USD 600.00

3 Weeks

Lenti ORF clone of Human olfactory receptor, family 4, subfamily A, member 47 (OR4A47), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OR4A47 (NM_001005512) Human Tagged Lenti ORF Clone
RC211764L4

USD 600.00

3 Weeks

Lenti ORF clone of Human olfactory receptor, family 4, subfamily A, member 47 (OR4A47), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OR4A47 (C-term) Rabbit Polyclonal Antibody
AP53047PU-N

USD 580.00

2 Weeks

OR4A47 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 205-233 amino acids from the C-terminal region of Human Olfactory receptor 4A47
OR4A47 Rabbit Polyclonal Antibody
TA337501

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR4A47 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR4A47 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4A47. Synthetic peptide located within the following region: ACTIVFLLLLISYGVILHSLKNLSQKGRQKALSTCSSHMTVVVFFFVPCI
OR4A47 (NM_001005512) Human Over-expression Lysate
LC423615

USD 134.00

2 Weeks

OR4A47 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OR4A47 (NM_001005512) Human Untagged Clone
SC300989

USD 330.00

2 Weeks

OR4A47 (untagged)-Human olfactory receptor, family 4, subfamily A, member 47 (OR4A47)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
OR4A47 CytoSection
TS411764P5

USD 1,174.00

4 Weeks

Transient overexpression of OR4A47 in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Applications IHC
Other Names OR11-113
Accession Number NM_001005512, NP_001005512