Products

cDNA Clones (7)
Proteins (3)
Antibodies (2)
Jump to Filters
View as table Download
OR2A25 (NM_001004488) Human Tagged ORF Clone
RC216800

USD 300.00

In Stock

OR2A25 (Myc-DDK-tagged)-Human olfactory receptor, family 2, subfamily A, member 25 (OR2A25)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
OR2A25 (NM_001004488) Human Tagged ORF Clone Lentiviral Particle
RC216800L3V

USD 850.00

5 Weeks

Lenti ORF particles, OR2A25 (Myc-DDK tagged) - Human olfactory receptor, family 2, subfamily A, member 25 (OR2A25), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OR2A25 (NM_001004488) Human Tagged ORF Clone Lentiviral Particle
RC216800L4V

USD 850.00

5 Weeks

Lenti ORF particles, OR2A25 (mGFP-tagged) - Human olfactory receptor, family 2, subfamily A, member 25 (OR2A25), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OR2A25 (NM_001004488) Human Tagged ORF Clone
RG216800

USD 500.00

3 Weeks

OR2A25 (tGFP-tagged) - Human olfactory receptor, family 2, subfamily A, member 25 (OR2A25)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OR2A25 (NM_001004488) Human Tagged Lenti ORF Clone
RC216800L4

USD 600.00

3 Weeks

Lenti ORF clone of Human olfactory receptor, family 2, subfamily A, member 25 (OR2A25), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OR2A25 (NM_001004488) Human Over-expression Lysate
LC423867

USD 134.00

In Stock

OR2A25 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OR2A25 Rabbit Polyclonal Antibody
TA337487

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR2A25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2A25 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2A25. Synthetic peptide located within the following region: LCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRN
OR2A25 Rabbit Polyclonal Antibody
TA337488

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR2A25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2A25 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2A25. Synthetic peptide located within the following region: IIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVQGTLKRML
OR2A25 (NM_001004488) Human Tagged Lenti ORF Clone
RC216800L3

USD 600.00

3 Weeks

Lenti ORF clone of Human olfactory receptor, family 2, subfamily A, member 25 (OR2A25), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OR2A25 (NM_001004488) Human Untagged Clone
SC300722

USD 330.00

2 Weeks

OR2A25 (untagged)-Human olfactory receptor, family 2, subfamily A, member 25 (OR2A25)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
OR2A25 CytoSection
TS416800P5

USD 1,174.00

4 Weeks

Transient overexpression of OR2A25 in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Applications IHC
Other Names OR2A24P; OR2A25P; OR2A27
Accession Number NM_001004488, NP_001004488