Products

cDNA Clones (7)
Proteins (3)
Antibodies (2)
Jump to Filters
View as table Download
OR1A2 (NM_012352) Human Tagged ORF Clone
RC217007

USD 300.00

In Stock

OR1A2 (Myc-DDK-tagged)-Human olfactory receptor, family 1, subfamily A, member 2 (OR1A2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
OR1A2 (NM_012352) Human Tagged ORF Clone Lentiviral Particle
RC217007L3V

USD 850.00

5 Weeks

Lenti ORF particles, OR1A2 (Myc-DDK tagged) - Human olfactory receptor, family 1, subfamily A, member 2 (OR1A2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OR1A2 (NM_012352) Human Tagged ORF Clone Lentiviral Particle
RC217007L4V

USD 850.00

5 Weeks

Lenti ORF particles, OR1A2 (mGFP-tagged) - Human olfactory receptor, family 1, subfamily A, member 2 (OR1A2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OR1A2 (NM_012352) Human Tagged ORF Clone
RG217007

USD 500.00

In Stock

OR1A2 (tGFP-tagged) - Human olfactory receptor, family 1, subfamily A, member 2 (OR1A2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OR1A2 (NM_012352) Human Tagged Lenti ORF Clone
RC217007L3

USD 600.00

3 Weeks

Lenti ORF clone of Human olfactory receptor, family 1, subfamily A, member 2 (OR1A2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OR1A2 (NM_012352) Human Tagged Lenti ORF Clone
RC217007L4

USD 600.00

3 Weeks

Lenti ORF clone of Human olfactory receptor, family 1, subfamily A, member 2 (OR1A2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OR1A2 Rabbit Polyclonal Antibody
TA331997

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR1A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR1A2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR1A2. Synthetic peptide located within the following region: YGTTMGMYFRPLTSYSPKDAVITVMYVAVTPALNPFIYSLRNWDMKAALQ
OR1A2 Rabbit Polyclonal Antibody
TA360400

USD 539.00

5 Days

OR1A2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human OR1A2
OR1A2 (NM_012352) Human Over-expression Lysate
LC415807

USD 134.00

2 Weeks

OR1A2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OR1A2 (NM_012352) Human Untagged Clone
SC303962

USD 330.00

3 Weeks

OR1A2 (untagged)-Human olfactory receptor, family 1, subfamily A, member 2 (OR1A2)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
OR1A2 CytoSection
TS417007P5

USD 1,174.00

4 Weeks

Transient overexpression of OR1A2 in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Applications IHC
Other Names OR17-6
Accession Number NM_012352, NP_036484