Germany
Japan
United Kingdom
China
OR11A1 (Myc-DDK-tagged)-Human olfactory receptor, family 11, subfamily A, member 1 (OR11A1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, OR11A1 (Myc-DDK tagged) - Human olfactory receptor, family 11, subfamily A, member 1 (OR11A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, OR11A1 (mGFP-tagged) - Human olfactory receptor, family 11, subfamily A, member 1 (OR11A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
OR11A1 (tGFP-tagged) - Human olfactory receptor, family 11, subfamily A, member 1 (OR11A1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human olfactory receptor, family 11, subfamily A, member 1 (OR11A1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human olfactory receptor, family 11, subfamily A, member 1 (OR11A1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
OR11A1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-OR11A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR11A1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR11A1. Synthetic peptide located within the following region: YVAPSAVHSQLLSKVFSLLYTVVTPLFNPVIYTMRNKEVHQALRKILCIK |
OR11A1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human OR11A1 |
Transient overexpression lysate of olfactory receptor, family 11, subfamily A, member 1 (OR11A1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
OR11A1 (untagged)-Human olfactory receptor, family 11, subfamily A, member 1 (OR11A1)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- OR11A1
Pathways
- Olfactory transduction