Products

cDNA Clones (7)
Proteins (3)
Antibodies (2)
Jump to Filters
View as table Download
OR10AD1 (NM_001004134) Human Tagged ORF Clone
RC221131

USD 300.00

In Stock

OR10AD1 (Myc-DDK-tagged)-Human olfactory receptor, family 10, subfamily AD, member 1 (OR10AD1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
OR10AD1 (NM_001004134) Human Tagged ORF Clone Lentiviral Particle
RC221131L3V

USD 850.00

5 Weeks

Lenti ORF particles, OR10AD1 (Myc-DDK tagged) - Human olfactory receptor, family 10, subfamily AD, member 1 (OR10AD1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OR10AD1 (NM_001004134) Human Tagged ORF Clone Lentiviral Particle
RC221131L4V

USD 850.00

5 Weeks

Lenti ORF particles, OR10AD1 (mGFP-tagged) - Human olfactory receptor, family 10, subfamily AD, member 1 (OR10AD1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OR10AD1 (NM_001004134) Human Tagged ORF Clone
RG221131

USD 500.00

3 Weeks

OR10AD1 (tGFP-tagged) - Human olfactory receptor, family 10, subfamily AD, member 1 (OR10AD1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OR10AD1 Rabbit Polyclonal Antibody
TA316053

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR10AD1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10AD1.
OR10AD1 (NM_001004134) Human Tagged Lenti ORF Clone
RC221131L3

USD 600.00

3 Weeks

Lenti ORF clone of Human olfactory receptor, family 10, subfamily AD, member 1 (OR10AD1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OR10AD1 (NM_001004134) Human Tagged Lenti ORF Clone
RC221131L4

USD 600.00

3 Weeks

Lenti ORF clone of Human olfactory receptor, family 10, subfamily AD, member 1 (OR10AD1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OR10AD1 (NM_001004134) Human Over-expression Lysate
LC424069

USD 134.00

In Stock

OR10AD1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OR10AD1 Rabbit Polyclonal Antibody
TA332332

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR10AD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10AD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10AD1. Synthetic peptide located within the following region: LSKASSSGRGKTFSTCASHLTVVIFLYTSAMFSYMNPHSTHGPDKDKPFS
OR10AD1 (NM_001004134) Human Untagged Clone
SC300608

USD 330.00

3 Weeks

OR10AD1 (untagged)-Human olfactory receptor, family 10, subfamily AD, member 1 (OR10AD1)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
OR10AD1 CytoSection
TS421131P5

USD 1,174.00

4 Weeks

Transient overexpression of OR10AD1 in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Applications IHC
Other Names OR10AD1P; OR12-1
Accession Number NM_001004134, NP_001004134