Germany
Japan
United Kingdom
China
GNPTAB (Myc-DDK-tagged)-Human N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits (GNPTAB)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, GNPTAB (Myc-DDK tagged) - Human N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits (GNPTAB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, GNPTAB (mGFP-tagged) - Human N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits (GNPTAB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, GNPTAB (Myc-DDK tagged) - Human N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits (GNPTAB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, GNPTAB (mGFP-tagged) - Human N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits (GNPTAB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GNPTAB (tGFP-tagged) - Human N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits (GNPTAB)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits (GNPTAB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits (GNPTAB)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits (GNPTAB), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits (GNPTAB), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-GNPTAB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNPTAB antibody: synthetic peptide directed towards the N terminal of human GNPTAB. Synthetic peptide located within the following region: FQFGEVVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNG |
GNPTAB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits (GNPTAB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
(untagged)-Human cDNA FLJ31575 fis, clone NT2RI2001846, moderately similar to Basic domain/leucine zipper transcription factor
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
GNPTAB (untagged)-Human N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits (GNPTAB)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- GNPTAB
Pathways
- Lysosome