Products

cDNA Clones (13)
Proteins (8)
Antibodies (3)
Jump to Filters
View as table Download
Junctional Adhesion Molecule 2 (JAM2) (NM_021219) Human Tagged ORF Clone Lentiviral Particle
RC204633L3V

USD 850.00

5 Weeks

Lenti ORF particles, JAM2 (Myc-DDK tagged) - Human junctional adhesion molecule 2 (JAM2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Junctional Adhesion Molecule 2 (JAM2) (NM_021219) Human Tagged ORF Clone Lentiviral Particle
RC204633L4V

USD 850.00

2 Weeks

Lenti ORF particles, JAM2 (mGFP-tagged) - Human junctional adhesion molecule 2 (JAM2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Junctional Adhesion Molecule 2 (JAM2) Rabbit Polyclonal Antibody
TA308335

USD 625.00

In Stock

Rabbit Polyclonal antibody to JAM-B (junctional adhesion molecule 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 294 of JAM-B (Uniprot ID#P57087)
Junctional Adhesion Molecule 2 (JAM2) Goat Polyclonal Antibody
TA305924

USD 520.00

5 Days

Goat Anti-JAM2 / JAMB / CD322 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-QRKGYFSKETSFQ, from the internal region of the protein sequence according to NP_067042.1.
Junctional Adhesion Molecule 2 (JAM2) Rabbit Polyclonal Antibody
TA338012

USD 539.00

5 Days

Rabbit Polyclonal Anti-JAM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JAM2 antibody is: synthetic peptide directed towards the middle region of Human JAM2. Synthetic peptide located within the following region: LVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPR