Products

View as table Download

CYBA (Myc-DDK-tagged)-Human cytochrome b-245, alpha polypeptide (CYBA)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, CYBA (Myc-DDK tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, CYBA (mGFP-tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF particles, CYBA (Myc-DDK tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CYBA (mGFP-tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CYBA (tGFP-tagged) - Human cytochrome b-245, alpha polypeptide (CYBA)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-CYBA Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYBA

Lenti ORF clone of Human cytochrome b-245, alpha polypeptide (CYBA), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human cytochrome b-245, alpha polypeptide (CYBA), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

CYBA (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 124-153 amino acids from the C-terminal region of Human Cytochrome b-245 light chain.

Rabbit Polyclonal Anti-CYBA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYBA antibody: synthetic peptide directed towards the middle region of human CYBA. Synthetic peptide located within the following region: TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP

Lenti ORF clone of Human cytochrome b-245, alpha polypeptide (CYBA), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

CYBA (untagged)-Human cytochrome b-245, alpha polypeptide (CYBA)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None