CYBA (Myc-DDK-tagged)-Human cytochrome b-245, alpha polypeptide (CYBA)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYBA (Myc-DDK-tagged)-Human cytochrome b-245, alpha polypeptide (CYBA)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CYBA (Myc-DDK tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF particles, CYBA (mGFP-tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF particles, CYBA (Myc-DDK tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYBA (mGFP-tagged) - Human cytochrome b-245, alpha polypeptide (CYBA), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CYBA (tGFP-tagged) - Human cytochrome b-245, alpha polypeptide (CYBA)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CYBA Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CYBA |
Lenti ORF clone of Human cytochrome b-245, alpha polypeptide (CYBA), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human cytochrome b-245, alpha polypeptide (CYBA), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human cytochrome b-245, alpha polypeptide (CYBA), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CYBA (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 124-153 amino acids from the C-terminal region of Human Cytochrome b-245 light chain. |
Transient overexpression lysate of cytochrome b-245, alpha polypeptide (CYBA)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-CYBA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYBA antibody: synthetic peptide directed towards the middle region of human CYBA. Synthetic peptide located within the following region: TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP |
Lenti ORF clone of Human cytochrome b-245, alpha polypeptide (CYBA), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
CYBA (untagged)-Human cytochrome b-245, alpha polypeptide (CYBA)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |