Products

cDNA Clones (11)
Antibodies (3)
Proteins (3)
Jump to Filters
View as table Download
Claudin 23 (CLDN23) (NM_194284) Human Tagged ORF Clone
RG221232

USD 650.00

In Stock

CLDN23 (tGFP-tagged) - Human claudin 23 (CLDN23)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 23 (CLDN23) Rabbit Polyclonal Antibody
TA349284

USD 380.00

In Stock

Rabbit Polyclonal Anti-CLDN23 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CLDN23
Claudin 23 (CLDN23) Rabbit Polyclonal Antibody
TA334206

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-CLDN23 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN23 antibody: synthetic peptide directed towards the C terminal of human CLDN23. Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE
Claudin 23 (CLDN23) (C-term) Rabbit Polyclonal Antibody
AP50948PU-N

USD 580.00

2 Weeks

Claudin 23 (CLDN23) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 235~265 amino acids from the C-terminal region of human CLDN23
Claudin 23 (CLDN23) (NM_194284) Human Over-expression Lysate
LC405122

USD 134.00

2 Weeks

CLDN23 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 23 (CLDN23) (NM_194284) Human Over-expression Lysate
LY405122

USD 436.00

5 Days

Transient overexpression lysate of claudin 23 (CLDN23)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB