Products

cDNA Clones (11)
Antibodies (9)
Proteins (9)
Jump to Filters
View as table Download
PCK1 (NM_002591) Human Tagged ORF Clone
RC204758

USD 579.00

In Stock

PCK1 (Myc-DDK-tagged)-Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PCK1 (NM_002591) Human Tagged ORF Clone Lentiviral Particle
RC204758L4V

USD 1,129.00

2 Weeks

Lenti ORF particles, PCK1 (mGFP-tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCK1 (NM_002591) Human Tagged ORF Clone Lentiviral Particle
RC204758L1V

USD 1,129.00

2 Weeks

Lenti ORF particles, PCK1 (Myc-DDK tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PCK1 (NM_002591) Human Tagged ORF Clone Lentiviral Particle
RC204758L2V

USD 1,129.00

5 Weeks

Lenti ORF particles, PCK1 (mGFP-tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PCK1 (NM_002591) Human Tagged ORF Clone Lentiviral Particle
RC204758L3V

USD 1,129.00

5 Weeks

Lenti ORF particles, PCK1 (Myc-DDK tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCK1 Rabbit Polyclonal Antibody
TA331174

USD 539.00

5 Days

Rabbit Polyclonal Anti-PCK1 Antibody

Applications WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
PCK1 Rabbit Polyclonal Antibody
TA331175

USD 485.00

5 Days

Rabbit Polyclonal Anti-PCK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
PCK1 (NM_002591) Human Tagged ORF Clone
RG204758

USD 779.00

In Stock

PCK1 (tGFP-tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PCK1 Rabbit Polyclonal Antibody
TA590679

USD 482.00

In Stock

Rabbit Polyclonal PCK1 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
PCK1 (NM_002591) Human Tagged Lenti ORF Clone
RC204758L1

USD 879.00

In Stock

Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PCK1 (513-524) Goat Polyclonal Antibody
AP22519PU-N

USD 500.00

2 Weeks

PCK1 (513-524) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Canine, Human, Mouse, Rat, Bat, Equine, Monkey, Rabbit
Conjugation Unconjugated
Immunogen Synthetic peptide from an internal region of human PCK1