Products

Antibodies (8)
cDNA Clones (7)
Proteins (3)
Jump to Filters
View as table Download
UQCRFS1 Mouse Monoclonal Antibody [Clone ID: OTI4H8]
TA811461

USD 447.00

In Stock

UQCRFS1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
UQCRFS1 Mouse Monoclonal Antibody [Clone ID: OTI4H8]
CF811461

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) UQCRFS1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
UQCRFS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H8]
TA811461AM

USD 509.00

2 Weeks

UQCRFS1 mouse monoclonal antibody,clone OTI4H8, Biotinylated

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Biotin
UQCRFS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H8]
TA811461BM

USD 509.00

2 Weeks

UQCRFS1 mouse monoclonal antibody,clone OTI4H8, HRP conjugated

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation HRP
UQCRFS1 (NM_006003) Human Tagged ORF Clone
RC204051

USD 450.00

In Stock

UQCRFS1 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
UQCRFS1 Mouse Monoclonal Antibody [Clone ID: OTI4H8]
TA811461S

USD 200.00

In Stock

UQCRFS1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
UQCRFS1 (NM_006003) Human Tagged ORF Clone
RG204051

USD 650.00

In Stock

UQCRFS1 (tGFP-tagged) - Human ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UQCRFS1 (C-term) Rabbit Polyclonal Antibody
AP54481PU-N

USD 580.00

2 Weeks

UQCRFS1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 188-217 amino acids from the C-terminal region of human UQCRFS1
UQCRFS1 Rabbit Polyclonal Antibody
TA308377

USD 625.00

In Stock

Rabbit Polyclonal antibody to UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1)

Applications IF, WB
Reactivities Human, Mouse (Predicted: Rat, Cow)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 274 of UQCRFS1 (Uniprot ID#P47985)
UQCRFS1 (NM_006003) Human Tagged Lenti ORF Clone
RC204051L4

USD 750.00

3 Weeks

Lenti-ORF clone of UQCRFS1 (mGFP-tagged)-Human ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1), nuclear gene encoding mitochondrial protein

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UQCRFS1 (NM_006003) Human Over-expression Lysate
LC416927

USD 134.00

In Stock

UQCRFS1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
UQCRFS1 (NM_006003) Human Over-expression Lysate
LY416927

USD 436.00

In Stock

Transient overexpression lysate of ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
UQCRFS1 (NM_006003) Human Tagged ORF Clone Lentiviral Particle
RC204051L3V

USD 1,000.00

5 Weeks

Lenti ORF particles, UQCRFS1 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UQCRFS1 (NM_006003) Human Tagged ORF Clone Lentiviral Particle
RC204051L4V

USD 1,000.00

5 Weeks

Lenti ORF particles, UQCRFS1 (mGFP-tagged)-Human ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 (UQCRFS1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UQCRFS1 Rabbit Polyclonal Antibody
TA344289

USD 539.00

5 Days

Rabbit Polyclonal Anti-UQCRFS1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRFS1 antibody: synthetic peptide directed towards the N terminal of human UQCRFS1. Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL