HAL (Myc-DDK-tagged)-Human histidine ammonia-lyase (HAL)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HAL (Myc-DDK-tagged)-Human histidine ammonia-lyase (HAL)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,467.00
5 Weeks
Lenti ORF particles, HAL (Myc-DDK tagged) - Human histidine ammonia-lyase (HAL), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 1,467.00
2 Weeks
Lenti ORF particles, HAL (mGFP-tagged) - Human histidine ammonia-lyase (HAL), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 1,467.00
5 Weeks
Lenti ORF particles, HAL (Myc-DDK tagged) - Human histidine ammonia-lyase (HAL), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,467.00
5 Weeks
Lenti ORF particles, HAL (mGFP-tagged) - Human histidine ammonia-lyase (HAL), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Recombinant protein of human histidine ammonia-lyase (HAL), 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
HAL (tGFP-tagged) - Human histidine ammonia-lyase (HAL)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HAL (Myc-DDK tagged) - Homo sapiens histidine ammonia-lyase (HAL), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HAL (tGFP-tagged) - Homo sapiens histidine ammonia-lyase (HAL), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human histidine ammonia-lyase (HAL), 1 mg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human histidine ammonia-lyase (HAL), 100 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
HAL (Myc-DDK tagged) - Homo sapiens histidine ammonia-lyase (HAL), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
HAL (tGFP-tagged) - Homo sapiens histidine ammonia-lyase (HAL), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human histidine ammonia-lyase (HAL), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-HAL Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HAL antibody: synthetic peptide directed towards the C terminal of human HAL. Synthetic peptide located within the following region: EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK |