Germany
Japan
United Kingdom
China
HAL (Myc-DDK-tagged)-Human histidine ammonia-lyase (HAL)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 1,467.00
5 Weeks
Lenti ORF particles, HAL (Myc-DDK tagged) - Human histidine ammonia-lyase (HAL), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
USD 1,467.00
2 Weeks
Lenti ORF particles, HAL (mGFP-tagged) - Human histidine ammonia-lyase (HAL), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
USD 1,467.00
5 Weeks
Lenti ORF particles, HAL (Myc-DDK tagged) - Human histidine ammonia-lyase (HAL), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,467.00
5 Weeks
Lenti ORF particles, HAL (mGFP-tagged) - Human histidine ammonia-lyase (HAL), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Recombinant protein of human histidine ammonia-lyase (HAL), 20 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
HAL (tGFP-tagged) - Human histidine ammonia-lyase (HAL)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
HAL (Myc-DDK tagged) - Homo sapiens histidine ammonia-lyase (HAL), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
HAL (tGFP-tagged) - Homo sapiens histidine ammonia-lyase (HAL), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human histidine ammonia-lyase (HAL), 1 mg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human histidine ammonia-lyase (HAL), 100 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
HAL (Myc-DDK tagged) - Homo sapiens histidine ammonia-lyase (HAL), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
HAL (tGFP-tagged) - Homo sapiens histidine ammonia-lyase (HAL), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human histidine ammonia-lyase (HAL), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-HAL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAL antibody: synthetic peptide directed towards the C terminal of human HAL. Synthetic peptide located within the following region: EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK |
Active filters
Target Symbol
- HISTIDASE
Pathways
- Histidine metabolism