Products

View as table Download

Lenti ORF particles, PRKCG (Myc-DDK tagged) - Human protein kinase C, gamma (PRKCG), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Lenti ORF particles, PRKCG (mGFP-tagged) - Human protein kinase C, gamma (PRKCG), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Lenti ORF particles, PRKCG (Myc-DDK tagged) - Human protein kinase C, gamma (PRKCG), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Lenti ORF particles, PRKCG (mGFP-tagged) - Human protein kinase C, gamma (PRKCG), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Recombinant protein of human protein kinase C, gamma (PRKCG), 20 µg

Tag C-Myc/DDK
Expression Host HEK293T

PRKCG (tGFP-tagged) - Human protein kinase C, gamma (PRKCG)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Recombinant protein of human protein kinase C, gamma (PRKCG), 1 mg

Tag C-Myc/DDK
Expression Host HEK293T

Recombinant protein of human protein kinase C, gamma (PRKCG), 100 µg

Tag C-Myc/DDK
Expression Host HEK293T

PRKCG (untagged)-Human protein kinase C, gamma (PRKCG)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal Anti-PRKCG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL

PRKCG (untagged)-Kinase deficient mutant (K380M) of Human protein kinase C, gamma (PRKCG)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None