PRKCG (Myc-DDK-tagged)-Human protein kinase C, gamma (PRKCG)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PRKCG (Myc-DDK-tagged)-Human protein kinase C, gamma (PRKCG)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,507.00
2 Weeks
Lenti ORF particles, PRKCG (Myc-DDK tagged) - Human protein kinase C, gamma (PRKCG), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
USD 1,507.00
2 Weeks
Lenti ORF particles, PRKCG (mGFP-tagged) - Human protein kinase C, gamma (PRKCG), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
USD 1,507.00
5 Weeks
Lenti ORF particles, PRKCG (Myc-DDK tagged) - Human protein kinase C, gamma (PRKCG), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
USD 1,507.00
5 Weeks
Lenti ORF particles, PRKCG (mGFP-tagged) - Human protein kinase C, gamma (PRKCG), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Recombinant protein of human protein kinase C, gamma (PRKCG), 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
PRKCG (tGFP-tagged) - Human protein kinase C, gamma (PRKCG)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human protein kinase C, gamma (PRKCG), 1 mg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Recombinant protein of human protein kinase C, gamma (PRKCG), 100 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
PRKCG (untagged)-Human protein kinase C, gamma (PRKCG)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human protein kinase C, gamma (PRKCG), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human protein kinase C, gamma (PRKCG), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit polyclonal Anti-PRKCG Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL |
PRKCG (untagged)-Kinase deficient mutant (K380M) of Human protein kinase C, gamma (PRKCG)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human protein kinase C, gamma (PRKCG), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |