Products

cDNA Clones (11)
Antibodies (4)
Proteins (3)
Jump to Filters
View as table Download
GPAT4 (NM_178819) Human Tagged ORF Clone
RC208614

USD 457.00

In Stock

AGPAT6 (Myc-DDK-tagged)-Human 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) (AGPAT6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GPAT4 (NM_178819) Human Tagged ORF Clone Lentiviral Particle
RC208614L1V

USD 1,007.00

2 Weeks

Lenti ORF particles, AGPAT6 (Myc-DDK tagged) - Human 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) (AGPAT6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GPAT4 (NM_178819) Human Tagged ORF Clone Lentiviral Particle
RC208614L2V

USD 1,007.00

5 Weeks

Lenti ORF particles, AGPAT6 (mGFP-tagged) - Human 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) (AGPAT6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GPAT4 (NM_178819) Human Tagged ORF Clone Lentiviral Particle
RC208614L3V

USD 1,007.00

5 Weeks

Lenti ORF particles, AGPAT6 (Myc-DDK tagged) - Human 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) (AGPAT6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPAT4 (NM_178819) Human Tagged ORF Clone Lentiviral Particle
RC208614L4V

USD 1,007.00

2 Weeks

Lenti ORF particles, AGPAT6 (mGFP-tagged) - Human 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) (AGPAT6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPAT4 (NM_178819) Human Tagged ORF Clone
RG208614

USD 657.00

In Stock

AGPAT6 (tGFP-tagged) - Human 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) (AGPAT6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPAT4 (NM_178819) Human Tagged Lenti ORF Clone
RC208614L1

USD 757.00

In Stock

Lenti ORF clone of Human 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) (AGPAT6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GPAT4 (NM_178819) Human Tagged Lenti ORF Clone
RC208614L4

USD 757.00

In Stock

Lenti ORF clone of Human 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) (AGPAT6), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPAT4 (NM_178819) Human Over-expression Lysate
LY403611

USD 436.00

In Stock

Transient overexpression lysate of 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) (AGPAT6)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

GPAT4 (NM_178819) Human Tagged Lenti ORF Clone
RC208614L2

USD 757.00

3 Weeks

Lenti ORF clone of Human 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) (AGPAT6), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GPAT4 (NM_178819) Human Tagged Lenti ORF Clone
RC208614L3

USD 757.00

3 Weeks

Lenti ORF clone of Human 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) (AGPAT6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPAT4 (NM_178819) Human Over-expression Lysate
LC403611

USD 134.00

In Stock

AGPAT6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GPAT4 (N-term) Rabbit Polyclonal Antibody
AP50113PU-N

USD 580.00

2 Weeks

GPAT4 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 52~82 amino acids from the N-terminal region of human AGPAT6
GPAT4 Rabbit Polyclonal Antibody
TA343066

USD 539.00

5 Days

Rabbit Polyclonal Anti-AGPAT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGPAT6 antibody: synthetic peptide directed towards the middle region of human AGPAT6. Synthetic peptide located within the following region: MSKHVHLMCYRICVRALTAIITYHDRENRPRNGGICVANHTSPIDVIILA
GPAT4 Rabbit Polyclonal Antibody
TA349456

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-AGPAT6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human AGPAT6