Products

Proteins (7)
cDNA Clones (7)
Antibodies (2)
Jump to Filters
View as table Download
GLUD2 (NM_012084) Human Tagged ORF Clone
RC208737

USD 519.00

In Stock

GLUD2 (Myc-DDK-tagged)-Human glutamate dehydrogenase 2 (GLUD2), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GLUD2 (NM_012084) Human Tagged ORF Clone Lentiviral Particle
RC208737L3V

USD 1,069.00

5 Weeks

Lenti ORF particles, GLUD2 (Myc-DDK tagged) - Human glutamate dehydrogenase 2 (GLUD2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GLUD2 (NM_012084) Human Tagged ORF Clone Lentiviral Particle
RC208737L4V

USD 1,069.00

5 Weeks

Lenti ORF particles, GLUD2 (mGFP-tagged) - Human glutamate dehydrogenase 2 (GLUD2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GLUD2 (NM_012084) Human Tagged ORF Clone
RG208737

USD 719.00

3 Weeks

GLUD2 (tGFP-tagged) - Human glutamate dehydrogenase 2 (GLUD2), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GLUD2 (NM_012084) Human Tagged Lenti ORF Clone
RC208737L3

USD 819.00

3 Weeks

Lenti ORF clone of Human glutamate dehydrogenase 2 (GLUD2), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GLUD2 (NM_012084) Human Tagged Lenti ORF Clone
RC208737L4

USD 819.00

3 Weeks

Lenti ORF clone of Human glutamate dehydrogenase 2 (GLUD2), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GLUD2 Rabbit Polyclonal Antibody
TA334426

USD 539.00

5 Days

Rabbit Polyclonal Anti-GLUD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD2 antibody: synthetic peptide directed towards the N terminal of human GLUD2. Synthetic peptide located within the following region: MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAAR
GLUD2 Rabbit Polyclonal Antibody
TA334427

USD 539.00

5 Days

Rabbit Polyclonal Anti-GLUD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD2 antibody: synthetic peptide directed towards the N terminal of human GLUD2. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF
GLUD2 (NM_012084) Human Over-expression Lysate
LC415988

USD 134.00

2 Weeks

GLUD2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GLUD2 (NM_012084) Human Over-expression Lysate
LY415988

USD 436.00

5 Days

Transient overexpression lysate of glutamate dehydrogenase 2 (GLUD2), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GLUD2 (NM_012084) Human Mass Spec Standard
PH308737

USD 3,255.00

3 Weeks

GLUD2 MS Standard C13 and N15-labeled recombinant protein (NP_036216)

Tag C-Myc/DDK
Expression Host HEK293
GLUD2 (NM_012084) Human Untagged Clone
SC321890

USD 520.00

In Stock

GLUD2 (untagged)-Human glutamate dehydrogenase 2 (GLUD2), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin