POLR3F (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
POLR3F (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, POLR3F (Myc-DDK tagged) - Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, POLR3F (mGFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
POLR3F (tGFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR3F (tGFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
POLR3F (myc-DDK-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal POLR3F Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | POLR3F antibody was raised against a 21 amino acid peptide from near the amino terminus of human POLR3F. |
Rabbit Polyclonal Anti-POLR3F Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR3F antibody: synthetic peptide directed towards the middle region of human POLR3F. Synthetic peptide located within the following region: LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE |
Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
POLR3F HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Purified recombinant protein of Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
Rabbit Polyclonal Anti-POLR3F Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR3F antibody: synthetic peptide directed towards the N terminal of human POLR3F. Synthetic peptide located within the following region: MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQR |
POLR3F (1-316, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
POLR3F (1-316, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |